Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IRS1 Rabbit pAb (A16902)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - IRS1 Rabbit pAb (A16902)

Western blot analysis of various lysates using IRS1 Rabbit pAb (A16902) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - IRS1 Rabbit pAb (A16902)

Western blot analysis of lysates from Hep G2 cells using IRS1 Rabbit pAb(A16902) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - IRS1 Rabbit pAb (A16902)

Immunohistochemistry analysis of IRS1 in paraffin-embedded human lung cancer tissue using IRS1 Rabbit pAb (A16902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - IRS1 Rabbit pAb (A16902)

Immunohistochemistry analysis of IRS1 in paraffin-embedded mouse spinal cord tissue using IRS1 Rabbit pAb (A16902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - IRS1 Rabbit pAb (A16902)

Immunohistochemistry analysis of IRS1 in paraffin-embedded rat heart tissue using IRS1 Rabbit pAb (A16902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - IRS1 Rabbit pAb (A16902)

Immunohistochemistry analysis of IRS1 in paraffin-embedded rat brain tissue using IRS1 Rabbit pAb (A16902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - IRS1 Rabbit pAb (A16902)

Immunofluorescence analysis of NIH/3T3 cells using IRS1 Rabbit pAb (A16902) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name IRS1 Rabbit pAb
Catalog No. A16902
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1043-1242 of human IRS1 (NP_005535.1).
Sequence SPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
Gene ID 3667
Swiss prot P35568
Synonyms HIRS-1; IRS1
Calculated MW 132kDa
Observed MW 180kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Hep G2, Mouse liver, Rat liver
Cellular location caveola, cytoplasm, cytosol, nucleoplasm, nucleus, plasma membrane
Customer validation

WB (Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IRS1 Rabbit pAb images

ABclonal:Western blot - IRS1 Rabbit pAb (A16902)}

Western blot - IRS1 Rabbit pAb (A16902)

Western blot analysis of various lysates using IRS1 Rabbit pAb (A16902) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - IRS1 Rabbit pAb (A16902)}

Western blot - IRS1 Rabbit pAb (A16902)

Western blot analysis of lysates from Hep G2 cells using IRS1 Rabbit pAb(A16902) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - IRS1 Rabbit pAb (A16902)}

Immunohistochemistry - IRS1 Rabbit pAb (A16902)

Immunohistochemistry analysis of IRS1 in paraffin-embedded human lung cancer tissue using IRS1 Rabbit pAb (A16902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - IRS1 Rabbit pAb (A16902)}

Immunohistochemistry - IRS1 Rabbit pAb (A16902)

Immunohistochemistry analysis of IRS1 in paraffin-embedded mouse spinal cord tissue using IRS1 Rabbit pAb (A16902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - IRS1 Rabbit pAb (A16902)}

Immunohistochemistry - IRS1 Rabbit pAb (A16902)

Immunohistochemistry analysis of IRS1 in paraffin-embedded rat heart tissue using IRS1 Rabbit pAb (A16902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - IRS1 Rabbit pAb (A16902)}

Immunohistochemistry - IRS1 Rabbit pAb (A16902)

Immunohistochemistry analysis of IRS1 in paraffin-embedded rat brain tissue using IRS1 Rabbit pAb (A16902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - IRS1 Rabbit pAb (A16902)}

Immunofluorescence - IRS1 Rabbit pAb (A16902)

Immunofluorescence analysis of NIH/3T3 cells using IRS1 Rabbit pAb (A16902) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16902 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IRS1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IRS1. (Distance between topics and target gene indicate popularity.) IRS1

* Data provided by citexs.com, for reference only.

Publishing research using A16902? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order