Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

IRS1 Rabbit mAb (A19074)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - IRS1 Rabbit mAb (A19074)

Western blot analysis of extracts of HepG2 cells, using IRS1 antibody (A19074) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

You may also interested in:

Overview

Product name IRS1 Rabbit mAb
Catalog No. A19074
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0486

Background

This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568).
Sequence SSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
Gene ID 3667
Swiss prot P35568
Synonyms HIRS-1; IRS1
Calculated MW 132kDa
Observed MW 170kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2
Cellular location Caveola, Cytoplasm, Cytosol, Nucleoplasm, Nucleus, Plasma membrane
Customer validation

WB (Mus musculus, Homo sapiens)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IRS1 Rabbit mAb images

ABclonal:Western blot - IRS1 Rabbit mAb (A19074)}

Western blot - IRS1 Rabbit mAb (A19074)

Western blot analysis of extracts of HepG2 cells, using IRS1 antibody (A19074) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Inquire About This Product

Submit your question about A19074 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IRS1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IRS1. (Distance between topics and target gene indicate popularity.) IRS1

* Data provided by citexs.com, for reference only.

Publishing research using A19074? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order