Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IRF7 Rabbit pAb (A0159)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - IRF7 Rabbit pAb (A0159)

Western blot analysis of extracts of Mouse liver, using IRF7 antibody (A0159) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name IRF7 Rabbit pAb
Catalog No. A0159
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. It has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. The encoded protein plays an important role in the innate immune response against DNA and RNA viruses.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2).
Sequence KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
Gene ID 3665
Swiss prot Q92985
Synonyms IMD39; IRF-7; IRF7A; IRF7B; IRF7C; IRF7H; IRF-7H; IRF7
Calculated MW 54kDa
Observed MW 65kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse liver
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Cynoglossus semilaevis, Mus musculus, Homo sapiens, Anatinae, Vaccinium myrtillus L)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IRF7 Rabbit pAb images

ABclonal:Western blot - IRF7 Rabbit pAb (A0159)}

Western blot - IRF7 Rabbit pAb (A0159)

Western blot analysis of extracts of Mouse liver, using IRF7 antibody (A0159) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A0159 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IRF7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IRF7. (Distance between topics and target gene indicate popularity.) IRF7

* Data provided by citexs.com, for reference only.

Publishing research using A0159? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order