Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IRF3 Rabbit pAb (A11118)

Publications (13) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - IRF3 Rabbit pAb (A11118)

Western blot analysis of lysates from 293T cells using IRF3 Rabbit pAb(A11118) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - IRF3 Rabbit pAb (A11118)

Immunohistochemistry analysis of IRF3 in paraffin-embedded human lung cancer using IRF3 Rabbit pAb (A11118) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - IRF3 Rabbit pAb (A11118)

Immunohistochemistry analysis of IRF3 in paraffin-embedded human esophageal cancer using IRF3 Rabbit pAb (A11118) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - IRF3 Rabbit pAb (A11118)

Immunofluorescence analysis of HeLa cells using IRF3 Rabbit pAb (A11118) at dilution of 1:100 (40x lens). Secondary antibody: ABflo® 488-conjugated Goat Anti-Rabbit IgG (H+L) (AS073) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - IRF3 Rabbit pAb (A11118)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg IRF3 antibody (A11118). Western blot was performed from the immunoprecipitate using IRF3 (A11118) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - IRF3 Rabbit pAb (A11118)

Chromatin immunoprecipitation analysis of extracts of HCT116 cell line, using IRF3 rabbit polyclonal antibody (A11118) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name IRF3 Rabbit pAb
Catalog No. A11118
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. The protein plays an important role in the innate immune response against DNA and RNA viruses. Mutations in this gene are associated with Encephalopathy, acute, infection-induced, herpes-specific, 7.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human IRF3 (NP_001184051.1).
Sequence PHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGE
Gene ID 3661
Swiss prot Q14653
Synonyms IIAE7; IRF3
Calculated MW 47kDa
Observed MW 47kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • ChIP 5μg antibody for 10μg-15μg of Chromatin
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Mus musculus, Mesocricetus auratus, Sus scrofa, Rattus norvegicus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IRF3 Rabbit pAb images

ABclonal:Western blot - IRF3 Rabbit pAb (A11118)}

Western blot - IRF3 Rabbit pAb (A11118)

Western blot analysis of lysates from 293T cells using IRF3 Rabbit pAb(A11118) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - IRF3 Rabbit pAb (A11118)}

Immunohistochemistry - IRF3 Rabbit pAb (A11118)

Immunohistochemistry analysis of IRF3 in paraffin-embedded human lung cancer using IRF3 Rabbit pAb (A11118) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - IRF3 Rabbit pAb (A11118)}

Immunohistochemistry - IRF3 Rabbit pAb (A11118)

Immunohistochemistry analysis of IRF3 in paraffin-embedded human esophageal cancer using IRF3 Rabbit pAb (A11118) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - IRF3 Rabbit pAb (A11118)}

Immunofluorescence - IRF3 Rabbit pAb (A11118)

Immunofluorescence analysis of HeLa cells using IRF3 Rabbit pAb (A11118) at dilution of 1:100 (40x lens). Secondary antibody: ABflo® 488-conjugated Goat Anti-Rabbit IgG (H+L) (AS073) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - IRF3 Rabbit pAb (A11118)}

Immunoprecipitation - IRF3 Rabbit pAb (A11118)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg IRF3 antibody (A11118). Western blot was performed from the immunoprecipitate using IRF3 (A11118) at a dilution of 1:1000.
ABclonal:Chromatin Immunoprecipitation - IRF3 Rabbit pAb (A11118)}

Chromatin Immunoprecipitation - IRF3 Rabbit pAb (A11118)

Chromatin immunoprecipitation analysis of extracts of HCT116 cell line, using IRF3 rabbit polyclonal antibody (A11118) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A11118 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IRF3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IRF3. (Distance between topics and target gene indicate popularity.) IRF3

* Data provided by citexs.com, for reference only.

Publishing research using A11118? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order