Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

IL4 Rabbit mAb (A22284)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - IL4 Rabbit mAb (A22284)

Western blot analysis of various lysates, using IL4 antibody (A22284) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name IL4 Rabbit mAb
Catalog No. A22284
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC56660

Background

Enables cytokine activity. Involved in several processes, including innate immune response in mucosa; negative regulation of white fat cell proliferation; and regulation of gene expression. Acts upstream of or within several processes, including T-helper cell differentiation; positive regulation of macromolecule metabolic process; and regulation of leukocyte activation. Located in external side of plasma membrane and extracellular space. Is expressed in several structures, including brain; colon; hemolymphoid system; liver; and placenta. Used to study Sjogren's syndrome; atopic dermatitis; and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in several diseases, including asthma (multiple); autoimmune disease (multiple); hepatitis B; hepatitis C; and pancreatic cancer (multiple). Orthologous to human IL4 (interleukin 4).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-140 of mouse IL4 (NP_067258.1).
Sequence HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Gene ID 16189
Swiss prot P07750
Synonyms Il-4; BSF-1; IL4
Calculated MW 16kDa
Observed MW 19kDa

Applications

Reactivity Mouse
Tested applications Testing results
WB Mouse
Recommended dilution
  • WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Recombinant Mouse IL4 protein
Cellular location External side of plasma membrane, Extracellular space

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

IL4 Rabbit mAb images

ABclonal:Western blot - IL4 Rabbit mAb (A22284)}

Western blot - IL4 Rabbit mAb (A22284)

Western blot analysis of various lysates, using IL4 antibody (A22284) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A22284 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Il4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Il4. (Distance between topics and target gene indicate popularity.) Il4

* Data provided by citexs.com, for reference only.

Publishing research using A22284? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (2)

Proteins (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order