Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IKKε Rabbit pAb (A16470)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Immunoprecipitation - IKKε Rabbit pAb (A16470)

Immunoprecipitation analysis of 200 μg extracts of K-562 cells, using 3 μg IKKε antibody (A16470). Western blot was performed from the immunoprecipitate using IKKε antibody (A16470) at a dilution of 1:1000.

You may also interested in:

Overview

Product name IKKε Rabbit pAb
Catalog No. A16470
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-620 of human IKKε (NP_001180251.1).
Sequence VARTSLLYLSSSLGTERFSSVAGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNH
Gene ID 9641
Swiss prot Q14164
Synonyms IKKE; IKKI; IKK-E; IKK-i; IKKε
Calculated MW 80kDa
Observed MW 110kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples K-562
Cellular location Cytoplasm, Nucleus, PML body
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IKKε Rabbit pAb images

ABclonal:Immunoprecipitation - IKKε Rabbit pAb (A16470)}

Immunoprecipitation - IKKε Rabbit pAb (A16470)

Immunoprecipitation analysis of 200 μg extracts of K-562 cells, using 3 μg IKKε antibody (A16470). Western blot was performed from the immunoprecipitate using IKKε antibody (A16470) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A16470 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IKBKE. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IKBKE. (Distance between topics and target gene indicate popularity.) IKBKE

* Data provided by citexs.com, for reference only.

Publishing research using A16470? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order