Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IGFBP2 Rabbit pAb (A0403)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - IGFBP2 Rabbit pAb (A0403)

Western blot analysis of extracts of various cell lines, using IGFBP2 antibody (A0403) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

You may also interested in:

Overview

Product name IGFBP2 Rabbit pAb
Catalog No. A0403
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IGFBP2 (NP_000588.2).
Sequence ACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTE
Gene ID 3485
Swiss prot P18065
Synonyms IBP2; IGF-BP53; IGFBP2
Calculated MW 35kDa
Observed MW 37kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples LO2, HeLa, SW480
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IGFBP2 Rabbit pAb images

ABclonal:Western blot - IGFBP2 Rabbit pAb (A0403)}

Western blot - IGFBP2 Rabbit pAb (A0403)

Western blot analysis of extracts of various cell lines, using IGFBP2 antibody (A0403) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Inquire About This Product

Submit your question about A0403 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IGFBP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IGFBP2. (Distance between topics and target gene indicate popularity.) IGFBP2

* Data provided by citexs.com, for reference only.

Publishing research using A0403? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order