Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IGF1 Rabbit pAb (A11985)

Publications (15) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - IGF1 Rabbit pAb (A11985)

Western blot analysis of various lysates using IGF1 Rabbit pAb (A11985) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - IGF1 Rabbit pAb (A11985)

Immunohistochemistry analysis of IGF1 in paraffin-embedded rat lung using IGF1 Rabbit pAb (A11985) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - IGF1 Rabbit pAb (A11985)

Immunohistochemistry analysis of IGF1 in paraffin-embedded mouse liver using IGF1 Rabbit pAb (A11985) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name IGF1 Rabbit pAb
Catalog No. A11985
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGF1 (NP_000609.1).
Sequence PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKN
Gene ID 3479
Swiss prot P05019
Synonyms IGF; MGF; IGFI; IGF-I; IGF1
Calculated MW 22kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples U-87MG, SKOV3, HeLa, Mouse liver, Mouse testis, Rat testis
Cellular location Secreted
Customer validation

WB (Mus musculus, Sus scrofa, Homo sapiens, Ctenopharyngodon idellus, Pampus argenteus, Oryctolagus cuniculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IGF1 Rabbit pAb images

ABclonal:Western blot - IGF1 Rabbit pAb (A11985)}

Western blot - IGF1 Rabbit pAb (A11985)

Western blot analysis of various lysates using IGF1 Rabbit pAb (A11985) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - IGF1 Rabbit pAb (A11985)}

Immunohistochemistry - IGF1 Rabbit pAb (A11985)

Immunohistochemistry analysis of IGF1 in paraffin-embedded rat lung using IGF1 Rabbit pAb (A11985) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - IGF1 Rabbit pAb (A11985)}

Immunohistochemistry - IGF1 Rabbit pAb (A11985)

Immunohistochemistry analysis of IGF1 in paraffin-embedded mouse liver using IGF1 Rabbit pAb (A11985) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A11985 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IGF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IGF1. (Distance between topics and target gene indicate popularity.) IGF1

* Data provided by citexs.com, for reference only.

Publishing research using A11985? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Proteins (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order