Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IGF1 Rabbit pAb (A0303)

Review (1) Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - IGF1 Rabbit pAb (A0303)

Western blot analysis of various lysates using IGF1 Rabbit pAb (A0303) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - IGF1 Rabbit pAb (A0303)

Immunohistochemistry analysis of IGF1 in paraffin-embedded human lung cancer using IGF1 Rabbit pAb (A0303) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for IGF1 Rabbit pAb(A0303)

You may also interested in:

Overview

Product name IGF1 Rabbit pAb
Catalog No. A0303
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGF1 (NP_000609.1).
Sequence PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKN
Gene ID 3479
Swiss prot P05019
Synonyms IGF; MGF; IGFI; IGF-I; IGF1
Calculated MW 22kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, Mouse testis
Cellular location Secreted
Customer validation

WB (H9c2Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IGF1 Rabbit pAb images

ABclonal:Western blot - IGF1 Rabbit pAb (A0303)}

Western blot - IGF1 Rabbit pAb (A0303)

Western blot analysis of various lysates using IGF1 Rabbit pAb (A0303) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - IGF1 Rabbit pAb (A0303)}

Immunohistochemistry - IGF1 Rabbit pAb (A0303)

Immunohistochemistry analysis of IGF1 in paraffin-embedded human lung cancer using IGF1 Rabbit pAb (A0303) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A0303

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0303 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IGF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IGF1. (Distance between topics and target gene indicate popularity.) IGF1

* Data provided by citexs.com, for reference only.

Publishing research using A0303? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Proteins (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order