Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IFITM2 Rabbit pAb (A15133)

Publications (2) Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - IFITM2 Rabbit pAb (A15133)

Western blot analysis of lysates from HeLa cells, using IFITM2 Rabbit pAb (A15133) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name IFITM2 Rabbit pAb
Catalog No. A15133
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 and belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFITM2 (NP_006426.2).
Sequence MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS
Gene ID 10581
Swiss prot Q01629
Synonyms 1-8D; DSPA2c; IFITM2
Calculated MW 15kDa
Observed MW 17kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Cell membrane, Single-pass membrane protein
Customer validation

WB (Homo sapiens)

Research Area

IFITM2 Rabbit pAb images

ABclonal:Western blot - IFITM2 Rabbit pAb (A15133)}

Western blot - IFITM2 Rabbit pAb (A15133)

Western blot analysis of lysates from HeLa cells, using IFITM2 Rabbit pAb (A15133) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A15133 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IFITM2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IFITM2. (Distance between topics and target gene indicate popularity.) IFITM2

* Data provided by citexs.com, for reference only.

Publishing research using A15133? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order