Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

IκBα Rabbit pAb (A11397)

Publications (21) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - IκBα Rabbit pAb (A11397)

Western blot analysis of various lysates using IκBα Rabbit pAb (A11397) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - IκBα Rabbit pAb (A11397)

Western blot analysis of lysates from Rat liver, using IκBα Rabbit pAb (A11397) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name IκBα Rabbit pAb
Catalog No. A11397
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 201-300 of human IκBα (NP_065390.1).
Sequence LLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
Gene ID 4792
Swiss prot P25963
Synonyms IKBA; MAD-3; NFKBI; EDAID2; IκBα
Calculated MW 36kDa
Observed MW 36kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 1:20 - 1:50
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples HeLa, NIH/3T3, Rat liver
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Mus musculus, Homo sapiens, Sus scrofa, Rattus norvegicus)

IHC (Rattus norvegicus)

IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IκBα Rabbit pAb images

ABclonal:Western blot - IκBα Rabbit pAb (A11397)}

Western blot - IκBα Rabbit pAb (A11397)

Western blot analysis of various lysates using IκBα Rabbit pAb (A11397) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - IκBα Rabbit pAb (A11397)}

Western blot - IκBα Rabbit pAb (A11397)

Western blot analysis of lysates from Rat liver, using IκBα Rabbit pAb (A11397) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A11397 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NFKBIA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NFKBIA. (Distance between topics and target gene indicate popularity.) NFKBIA

* Data provided by citexs.com, for reference only.

Publishing research using A11397? Please let us know so that we can cite the reference in this datasheet.

Antibodies (13)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order