Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Human IgG (Fc) Rabbit mAb (A21291)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - Human IgG (Fc) Rabbit mAb (A21291)

Western blot analysis of lysates from control Human plasma, using Human IgG (Fc) Rabbit mAb (A21291) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.2s.

ABclonal:Immunohistochemistry - Human IgG (Fc) Rabbit mAb (A21291)

Immunohistochemistry analysis of Human IgG (Fc) in paraffin-embedded human colon carcinoma using Human IgG (Fc) Rabbit mAb (A21291) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Human IgG (Fc) Rabbit mAb (A21291)

Confocal imaging of human tonsil using Human IgG (Fc) Rabbit mAb (A21291, at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

You may also interested in:

Overview

Product name Human IgG (Fc) Rabbit mAb
Catalog No. A21291
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC53376

Background

Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response; positive regulation of hypersensitivity; and positive regulation of phagocytosis. Located in extracellular space.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human IgG (Fc) mAb (P01857).
Sequence PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene ID 3500, 3501, 3502, 3503
Swiss prot P01857, P01859, P01860, P01861
Synonyms
Calculated MW 52kDa
Observed MW 50-55kDa

Applications

Reactivity Human
Tested applications Testing results
IF/ICC Human
WB Human
IHC-P Human
Recommended dilution
  • WB 1:2000 - 1:20000
  • IHC-P 1:100 - 1:500
  • IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Human plasma
Cellular location

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Human IgG (Fc) Rabbit mAb images

ABclonal:Western blot - Human IgG (Fc) Rabbit mAb (A21291)}

Western blot - Human IgG (Fc) Rabbit mAb (A21291)

Western blot analysis of lysates from control Human plasma, using Human IgG (Fc) Rabbit mAb (A21291) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.2s.
ABclonal:Immunohistochemistry - Human IgG (Fc) Rabbit mAb (A21291)}

Immunohistochemistry - Human IgG (Fc) Rabbit mAb (A21291)

Immunohistochemistry analysis of Human IgG (Fc) in paraffin-embedded human colon carcinoma using Human IgG (Fc) Rabbit mAb (A21291) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Human IgG (Fc) Rabbit mAb (A21291)}

Immunofluorescence - Human IgG (Fc) Rabbit mAb (A21291)

Confocal imaging of human tonsil using Human IgG (Fc) Rabbit mAb (A21291, at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Inquire About This Product

Submit your question about A21291 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IGHG1, IGHG2, IGHG3, IGHG4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IGHG1, IGHG2, IGHG3, IGHG4. (Distance between topics and target gene indicate popularity.) IGHG1, IGHG2, IGHG3, IGHG4

* Data provided by citexs.com, for reference only.

Publishing research using A21291? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order