Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Histone H4 Rabbit mAb (A23000)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:ChIP-seq - Histone H4 Rabbit mAb (A23000)

Chromatin immunoprecipitations were performed with cross-linked chromatin from Hela cells and Histone H4 mAb (A23000). The ChIP sequencing results indicate the enrichment pattern of Histone H4 in selected genomic region and representative gene loci (GAPDH), as shown in figure.

ABclonal:Western blot - Histone H4 Rabbit mAb (A23000)

Western blot analysis of various lysates, using Histone H4 Rabbit mAb (A23000) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Histone H4 Rabbit mAb (A23000)

Immunohistochemistry analysis of Histone H4 in paraffin-embedded rat lung tissue using Histone H4 Rabbit mAb (A23000) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Histone H4 Rabbit mAb (A23000)

Immunohistochemistry analysis of Histone H4 in paraffin-embedded rat brain tissue using Histone H4 Rabbit mAb (A23000) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Histone H4 Rabbit mAb (A23000)

Immunohistochemistry analysis of Histone H4 in paraffin-embedded mouse colon tissue using Histone H4 Rabbit mAb (A23000) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Histone H4 Rabbit mAb (A23000)

Immunohistochemistry analysis of Histone H4 in paraffin-embedded human cervix cancer tissue using Histone H4 Rabbit mAb (A23000) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Histone H4 Rabbit mAb (A23000)

Immunofluorescence analysis of NIH/3T3 cells using Histone H4 Rabbit mAb (A23000) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Histone H4 Rabbit mAb (A23000)

Immunofluorescence analysis of PC-12 cells using Histone H4 Rabbit mAb (A23000) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - Histone H4 Rabbit mAb (A23000)

Chromatin immunoprecipitation analysis of extracts of cells, using Histone H4 antibody (A23000) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name Histone H4 Rabbit mAb
Catalog No. A23000
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC57963

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4(NP_003529.1)
Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID 8359
Swiss prot P62805
Synonyms H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Histone H4
Calculated MW 11kDa
Observed MW

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications Testing results
IHC-P HumanMouseRat
WB HumanMouse
IF/ICC MouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:500 - 1:1000
  • IF/ICC 1:100 - 1:500
  • ChIP 5μg antibody for 5μg-10μg of Chromatin
  • ChIP-seq 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, C2C12
Cellular location Chromosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Histone H4 Rabbit mAb images

ABclonal:ChIP-seq - Histone H4 Rabbit mAb (A23000)}

ChIP-seq - Histone H4 Rabbit mAb (A23000)

Chromatin immunoprecipitations were performed with cross-linked chromatin from Hela cells and Histone H4 mAb (A23000). The ChIP sequencing results indicate the enrichment pattern of Histone H4 in selected genomic region and representative gene loci (GAPDH), as shown in figure.
ABclonal:Western blot - Histone H4 Rabbit mAb (A23000)}

Western blot - Histone H4 Rabbit mAb (A23000)

Western blot analysis of various lysates, using Histone H4 Rabbit mAb (A23000) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
ABclonal:Immunohistochemistry - Histone H4 Rabbit mAb (A23000)}

Immunohistochemistry - Histone H4 Rabbit mAb (A23000)

Immunohistochemistry analysis of Histone H4 in paraffin-embedded rat lung tissue using Histone H4 Rabbit mAb (A23000) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Histone H4 Rabbit mAb (A23000)}

Immunohistochemistry - Histone H4 Rabbit mAb (A23000)

Immunohistochemistry analysis of Histone H4 in paraffin-embedded rat brain tissue using Histone H4 Rabbit mAb (A23000) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Histone H4 Rabbit mAb (A23000)}

Immunohistochemistry - Histone H4 Rabbit mAb (A23000)

Immunohistochemistry analysis of Histone H4 in paraffin-embedded mouse colon tissue using Histone H4 Rabbit mAb (A23000) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Histone H4 Rabbit mAb (A23000)}

Immunohistochemistry - Histone H4 Rabbit mAb (A23000)

Immunohistochemistry analysis of Histone H4 in paraffin-embedded human cervix cancer tissue using Histone H4 Rabbit mAb (A23000) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - Histone H4 Rabbit mAb (A23000)}

Immunofluorescence - Histone H4 Rabbit mAb (A23000)

Immunofluorescence analysis of NIH/3T3 cells using Histone H4 Rabbit mAb (A23000) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Histone H4 Rabbit mAb (A23000)}

Immunofluorescence - Histone H4 Rabbit mAb (A23000)

Immunofluorescence analysis of PC-12 cells using Histone H4 Rabbit mAb (A23000) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Chromatin Immunoprecipitation - Histone H4 Rabbit mAb (A23000)}

Chromatin Immunoprecipitation - Histone H4 Rabbit mAb (A23000)

Chromatin immunoprecipitation analysis of extracts of cells, using Histone H4 antibody (A23000) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A23000 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H4C14. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H4C14. (Distance between topics and target gene indicate popularity.) H4C14

* Data provided by citexs.com, for reference only.

Publishing research using A23000? Please let us know so that we can cite the reference in this datasheet.

Antibodies (33)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order