Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Histone H2A.1 Rabbit pAb (A9895)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - Histone H2A.1 Rabbit pAb (A9895)

Western blot analysis of various lysates using Histone H2A.1 Rabbit pAb (A9895) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)

Immunohistochemistry analysis of Histone H2A.1 in paraffin-embedded rat kidney using Histone H2A.1 Rabbit pAb (A9895) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)

Immunohistochemistry analysis of Histone H2A.1 in paraffin-embedded human stomach using Histone H2A.1 Rabbit pAb (A9895) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)

Immunohistochemistry analysis of Histone H2A.1 in paraffin-embedded mouse heart using Histone H2A.1 Rabbit pAb (A9895) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Histone H2A.1 Rabbit pAb
Catalog No. A9895
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human Histone H2A.1 (NP_064707.1).
Sequence MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLF
Gene ID 30128329
Swiss prot P04908P0C0S8
Synonyms H2A/c; H2AFC; H2AC11; H2AC15; H2AC16; H2AC17; HIST1H2AI; Histone H2A.1
Calculated MW 14kDa
Observed MW 14kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples MCF7, SW480, A-549, HeLa, K-562, Mouse heart, Mouse intestine
Cellular location Chromosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Histone H2A.1 Rabbit pAb images

ABclonal:Western blot - Histone H2A.1 Rabbit pAb (A9895)}

Western blot - Histone H2A.1 Rabbit pAb (A9895)

Western blot analysis of various lysates using Histone H2A.1 Rabbit pAb (A9895) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)}

Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)

Immunohistochemistry analysis of Histone H2A.1 in paraffin-embedded rat kidney using Histone H2A.1 Rabbit pAb (A9895) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)}

Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)

Immunohistochemistry analysis of Histone H2A.1 in paraffin-embedded human stomach using Histone H2A.1 Rabbit pAb (A9895) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)}

Immunohistochemistry - Histone H2A.1 Rabbit pAb (A9895)

Immunohistochemistry analysis of Histone H2A.1 in paraffin-embedded mouse heart using Histone H2A.1 Rabbit pAb (A9895) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A9895 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H2AC13. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H2AC13. (Distance between topics and target gene indicate popularity.) H2AC13

* Data provided by citexs.com, for reference only.

Publishing research using A9895? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order