Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Hexokinase II Rabbit pAb (A0994)

Reviews (4) Publications (36) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Hexokinase II Rabbit pAb (A0994)

Western blot analysis of various lysates, using Hexokinase II Rabbit pAb (A0994) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)

Immunohistochemistry analysis of Hexokinase II in paraffin-embedded human breast cancer using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)

Immunohistochemistry analysis of Hexokinase II in paraffin-embedded human colon using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)

Immunohistochemistry analysis of Hexokinase II in paraffin-embedded mouse heart using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)

Immunohistochemistry analysis of Hexokinase II in paraffin-embedded rat heart using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Hexokinase II Rabbit pAb (A0994)

Immunofluorescence analysis of NIH/3T3 cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Hexokinase II Rabbit pAb (A0994)

Immunofluorescence analysis of PC-12 cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Hexokinase II Rabbit pAb (A0994)

Immunofluorescence analysis of U2OS cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Hexokinase II Rabbit pAb(A0994)
Review
ABclonal: review for Hexokinase II Rabbit pAb(A0994)
Review
ABclonal: review for Hexokinase II Rabbit pAb(A0994)
Review
ABclonal: review for Hexokinase II Rabbit pAb(A0994)

You may also interested in:

Overview

Product name Hexokinase II Rabbit pAb
Catalog No. A0994
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2).
Sequence MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
Gene ID 3099
Swiss prot P52789
Synonyms HKII; HXK2; Hexokinase II
Calculated MW 102kDa
Observed MW 102kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples RD, Mouse skeletal muscle
Cellular location Mitochondrion outer membrane
Customer validation

WB (H460, unknow, SK-N-SH, U251,U87MGHomo sapiens, Mus musculus, Rattus norvegicus, Homo sapiens, Sus scrofa, Gallus gallus)

IF (Homo sapiens, Gallus gallus)

IHC (Mus musculus, Homo sapiens, Rattus norvegicus)

/ (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Hexokinase II Rabbit pAb images

ABclonal:Western blot - Hexokinase II Rabbit pAb (A0994)}

Western blot - Hexokinase II Rabbit pAb (A0994)

Western blot analysis of various lysates, using Hexokinase II Rabbit pAb (A0994) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)}

Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)

Immunohistochemistry analysis of Hexokinase II in paraffin-embedded human breast cancer using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)}

Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)

Immunohistochemistry analysis of Hexokinase II in paraffin-embedded human colon using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)}

Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)

Immunohistochemistry analysis of Hexokinase II in paraffin-embedded mouse heart using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)}

Immunohistochemistry - Hexokinase II Rabbit pAb (A0994)

Immunohistochemistry analysis of Hexokinase II in paraffin-embedded rat heart using Hexokinase II Rabbit pAb (A0994) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Hexokinase II Rabbit pAb (A0994)}

Immunofluorescence - Hexokinase II Rabbit pAb (A0994)

Immunofluorescence analysis of NIH/3T3 cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Hexokinase II Rabbit pAb (A0994)}

Immunofluorescence - Hexokinase II Rabbit pAb (A0994)

Immunofluorescence analysis of PC-12 cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Hexokinase II Rabbit pAb (A0994)}

Immunofluorescence - Hexokinase II Rabbit pAb (A0994)

Immunofluorescence analysis of U2OS cells using Hexokinase II Rabbit pAb (A0994) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A0994

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0994 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HK2. (Distance between topics and target gene indicate popularity.) HK2

* Data provided by citexs.com, for reference only.

Publishing research using A0994? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order