Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HSP27/HSPB1 Rabbit pAb (A0240)

Reviews (4) Publications (12) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

Review
ABclonal: review for HSP27/HSPB1 Rabbit pAb(A0240)
Review
ABclonal: review for HSP27/HSPB1 Rabbit pAb(A0240)
Review
ABclonal: review for HSP27/HSPB1 Rabbit pAb(A0240)
Review
ABclonal: review for HSP27/HSPB1 Rabbit pAb(A0240)

You may also interested in:

Overview

Product name HSP27/HSPB1 Rabbit pAb
Catalog No. A0240
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HSP27/HSPB1 (NP_001531.1).
Sequence MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLD
Gene ID 3315
Swiss prot P04792
Synonyms CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067; HEL-S-102; HSP27/HSPB1
Calculated MW 23kDa
Observed MW 25kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, HeLa
Cellular location Cytoplasm, Nucleus, cytoskeleton, spindle
Customer validation

WB (Mouse N2a,Mouse kidney, HepG2, HeLaRattus norvegicus, Homo sapiens, Toxoplasma gondii, Rattus norvegicus, Mus musculus)

IHC (Mouse N2a,Mouse kidneyHomo sapiens, Mus musculus)

Co-IP (Homo sapiens)

IF (Homo sapiens)

Research Area

Submit an review for A0240

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0240 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HSPB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HSPB1. (Distance between topics and target gene indicate popularity.) HSPB1

* Data provided by citexs.com, for reference only.

Publishing research using A0240? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order