Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] HNRNPF Rabbit pAb (A5505)

KO/KDValidated

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - [KO Validated] HNRNPF Rabbit pAb (A5505)

Western blot analysis of extracts of various cell lines, using HNRNPF antibody (A5505) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] HNRNPF Rabbit pAb (A5505)

Western blot analysis of extracts from wild type(WT) and HNRNPF knockout (KO) 293T cells, using HNRNPF antibody (A5505) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - [KO Validated] HNRNPF Rabbit pAb (A5505)

Immunofluorescence analysis of U2OS cells using HNRNPF antibody (A5505). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] HNRNPF Rabbit pAb
Catalog No. A5505
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs which have guanosine-rich sequences. This protein is very similar to the family member hnRPH. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human HNRNPF (NP_001091678.1).
Sequence MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSE
Gene ID 3185
Swiss prot P52597
Synonyms HNRPF; mcs94-1; OK/SW-cl.23; PF
Calculated MW 46kDa
Observed MW 47kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 22Rv1, Lovo, MCF7, BT-474, Mouse spleen
Cellular location Nucleus, nucleoplasm
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] HNRNPF Rabbit pAb images

ABclonal:Western blot - [KO Validated] HNRNPF Rabbit pAb (A5505)}

Western blot - [KO Validated] HNRNPF Rabbit pAb (A5505)

Western blot analysis of extracts of various cell lines, using HNRNPF antibody (A5505) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] HNRNPF Rabbit pAb (A5505)}

Western blot - [KO Validated] HNRNPF Rabbit pAb (A5505)

Western blot analysis of extracts from wild type(WT) and HNRNPF knockout (KO) 293T cells, using HNRNPF antibody (A5505) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunofluorescence - [KO Validated] HNRNPF Rabbit pAb (A5505)}

Immunofluorescence - [KO Validated] HNRNPF Rabbit pAb (A5505)

Immunofluorescence analysis of U2OS cells using HNRNPF antibody (A5505). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5505 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HNRNPF. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HNRNPF. (Distance between topics and target gene indicate popularity.) HNRNPF

* Data provided by citexs.com, for reference only.

Publishing research using A5505? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order