Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HNRNPCL1 Rabbit pAb (A16011)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - HNRNPCL1 Rabbit pAb (A16011)

Western blot analysis of extracts of various cell lines, using HNRNPCL1 antibody (A16011) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name HNRNPCL1 Rabbit pAb
Catalog No. A16011
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables identical protein binding activity. Predicted to be active in nucleus.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HNRNPCL1 (NP_001013653.1).
Sequence NLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMESEGGAEDSAEEGDPLDDDVNEDQGDDQLELIKDDEKEAEEGEDDRDSTNGQDDS
Gene ID 343069
Swiss prot O60812
Synonyms HNRPCL1; HNRNPCL1
Calculated MW 32kDa
Observed MW 43kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples THP-1, MCF7
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

HNRNPCL1 Rabbit pAb images

ABclonal:Western blot - HNRNPCL1 Rabbit pAb (A16011)}

Western blot - HNRNPCL1 Rabbit pAb (A16011)

Western blot analysis of extracts of various cell lines, using HNRNPCL1 antibody (A16011) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A16011 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HNRNPCL1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HNRNPCL1. (Distance between topics and target gene indicate popularity.) HNRNPCL1

* Data provided by citexs.com, for reference only.

Publishing research using A16011? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order