Publications (13) Datasheet SDS
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | HIF-1alpha Rabbit mAb |
---|---|
Catalog No. | A22041 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0135 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human HIF1α (NP_001521.1). |
---|---|
Sequence | TVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT |
Gene ID | 3091 |
Swiss prot | Q16665 |
Synonyms | HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha |
Calculated MW | 93kDa |
Observed MW | 120kDa |
Reactivity | Human |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HeLa |
Cellular location | axon cytoplasm, cytoplasm, cytosol, nuclear body, nuclear speck, nucleoplasm, nucleus |
Customer validation | WB (Rattus norvegicus, Mus musculus, Homo sapiens, Gallus gallus) IF (Mus musculus, Gallus gallus, Rattus norvegicus) IHC (Homo sapiens, Mus musculus, Rattus norvegicus) |
Submit your question about A22041 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on HIF1A. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to HIF1A. (Distance between topics and target gene indicate popularity.) HIF1A
* Data provided by citexs.com, for reference only.
Publishing research using A22041? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.