Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

HIF-1alpha Rabbit mAb (A22041)

Publications (13) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - HIF-1alpha Rabbit mAb (A22041)

Western blot analysis of lysates from HeLa cells, using HIF-1alpha Rabbit mAb (A22041) at 1:1000 dilution.HeLa cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name HIF-1alpha Rabbit mAb
Catalog No. A22041
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0135

Background

This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human HIF1α (NP_001521.1).
Sequence TVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT
Gene ID 3091
Swiss prot Q16665
Synonyms HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha
Calculated MW 93kDa
Observed MW 120kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location axon cytoplasm, cytoplasm, cytosol, nuclear body, nuclear speck, nucleoplasm, nucleus
Customer validation

WB (Rattus norvegicus, Mus musculus, Homo sapiens, Gallus gallus)

IF (Mus musculus, Gallus gallus, Rattus norvegicus)

IHC (Homo sapiens, Mus musculus, Rattus norvegicus)

Research Area

HIF-1alpha Rabbit mAb images

ABclonal:Western blot - HIF-1alpha Rabbit mAb (A22041)}

Western blot - HIF-1alpha Rabbit mAb (A22041)

Western blot analysis of lysates from HeLa cells, using HIF-1alpha Rabbit mAb (A22041) at 1:1000 dilution.HeLa cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A22041 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HIF1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HIF1A. (Distance between topics and target gene indicate popularity.) HIF1A

* Data provided by citexs.com, for reference only.

Publishing research using A22041? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order