Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HIF1β/ARNT Rabbit pAb (A16990)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)

Immunofluorescence analysis of H9C2 cells using HIF1β/ARNT Rabbit pAb (A16990) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)

Immunofluorescence analysis of NIH-3T3 cells using HIF1β/ARNT Rabbit pAb (A16990) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)

Immunofluorescence analysis of U-S OS cells using HIF1β/ARNT Rabbit pAb (A16990) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name HIF1β/ARNT Rabbit pAb
Catalog No. A16990
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 465-570 of human HIF1β/ARNT (NP_001659.1).
Sequence KNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSK
Gene ID 405
Swiss prot P27540
Synonyms HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta; HIF1β/ARNT
Calculated MW 87kDa
Observed MW Refer to figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HIF1β/ARNT Rabbit pAb images

ABclonal:Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)}

Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)

Immunofluorescence analysis of H9C2 cells using HIF1β/ARNT Rabbit pAb (A16990) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)}

Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)

Immunofluorescence analysis of NIH-3T3 cells using HIF1β/ARNT Rabbit pAb (A16990) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)}

Immunofluorescence - HIF1β/ARNT Rabbit pAb (A16990)

Immunofluorescence analysis of U-S OS cells using HIF1β/ARNT Rabbit pAb (A16990) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16990 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ARNT. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ARNT. (Distance between topics and target gene indicate popularity.) ARNT

* Data provided by citexs.com, for reference only.

Publishing research using A16990? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order