Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HIF1AN/FIH1 Rabbit pAb (A21823)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - HIF1AN/FIH1 Rabbit pAb (A21823)

Western blot analysis of various lysates using HIF1AN/FIH1 Rabbit pAb (A21823) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - HIF1AN/FIH1 Rabbit pAb (A21823)

Western blot analysis of lysates from 3T3-L1 cells using HIF1AN/FIH1 Rabbit pAb(A21823) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name HIF1AN/FIH1 Rabbit pAb
Catalog No. A21823
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables several functions, including 2-oxoglutarate-dependent dioxygenase activity; NF-kappaB binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of Notch signaling pathway; negative regulation of transcription from RNA polymerase II promoter in response to hypoxia; and protein hydroxylation. Located in cytosol; nucleoplasm; and perinuclear region of cytoplasm. Colocalizes with nucleus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-349 of human HIF1AN/FIH1 (NP_060372.2).
Sequence MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Gene ID 55662
Swiss prot Q9NWT6
Synonyms FIH1; HIF1AN/FIH1
Calculated MW 41kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF7, Mouse heart, 3T3-L1
Cellular location Cytoplasm, Nucleus, perinuclear region

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HIF1AN/FIH1 Rabbit pAb images

ABclonal:Western blot - HIF1AN/FIH1 Rabbit pAb (A21823)}

Western blot - HIF1AN/FIH1 Rabbit pAb (A21823)

Western blot analysis of various lysates using HIF1AN/FIH1 Rabbit pAb (A21823) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - HIF1AN/FIH1 Rabbit pAb (A21823)}

Western blot - HIF1AN/FIH1 Rabbit pAb (A21823)

Western blot analysis of lysates from 3T3-L1 cells using HIF1AN/FIH1 Rabbit pAb(A21823) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A21823 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HIF1AN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HIF1AN. (Distance between topics and target gene indicate popularity.) HIF1AN

* Data provided by citexs.com, for reference only.

Publishing research using A21823? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order