Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HDAC4 Rabbit pAb (A7951)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HDAC4 Rabbit pAb (A7951)

Western blot analysis of extracts of various cell lines, using HDAC4 antibody (A7951) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

You may also interested in:

Overview

Product name HDAC4 Rabbit pAb
Catalog No. A7951
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (NP_006028.2).
Sequence MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQL
Gene ID 9759
Swiss prot P56524
Synonyms HD4; AHO3; BDMR; HDACA; HA6116; HDAC-4; HDAC-A; NEDCHF; NEDCHID; HDAC4
Calculated MW 119kDa
Observed MW 140kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, SW620, Mouse brain
Cellular location Cytoplasm, Nucleus

Research Area

HDAC4 Rabbit pAb images

ABclonal:Western blot - HDAC4 Rabbit pAb (A7951)}

Western blot - HDAC4 Rabbit pAb (A7951)

Western blot analysis of extracts of various cell lines, using HDAC4 antibody (A7951) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

Inquire About This Product

Submit your question about A7951 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HDAC4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HDAC4. (Distance between topics and target gene indicate popularity.) HDAC4

* Data provided by citexs.com, for reference only.

Publishing research using A7951? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order