Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

HDAC2 Rabbit mAb (A19626)

Review (1) Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HDAC2 Rabbit mAb (A19626)

Western blot analysis of various lysates using HDAC2 Rabbit mAb (A19626) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - HDAC2 Rabbit mAb (A19626)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg HDAC2 antibody (A19626). Western blot was performed from the immunoprecipitate using HDAC2 antibody (A19626) at a dilution of 1:1000.

Review
ABclonal: review for HDAC2 Rabbit mAb(A19626)

You may also interested in:

Overview

Product name HDAC2 Rabbit mAb
Catalog No. A19626
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2647

Background

This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC2 (NP_001518.3).
Sequence MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGED
Gene ID 3066
Swiss prot Q92769
Synonyms HD2; RPD3; YAF1; KDAC2; HDAC2
Calculated MW 55kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples HeLa, 293T, NIH/3T3, C6, Mouse liver
Cellular location Cytoplasm, Nucleus
Customer validation

(HT29、SNB-19、A549、PC-3、Ramos、U87-MG)

WB (Rattus norvegicus, Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HDAC2 Rabbit mAb images

ABclonal:Western blot - HDAC2 Rabbit mAb (A19626)}

Western blot - HDAC2 Rabbit mAb (A19626)

Western blot analysis of various lysates using HDAC2 Rabbit mAb (A19626) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunoprecipitation - HDAC2 Rabbit mAb (A19626)}

Immunoprecipitation - HDAC2 Rabbit mAb (A19626)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg HDAC2 antibody (A19626). Western blot was performed from the immunoprecipitate using HDAC2 antibody (A19626) at a dilution of 1:1000.

Submit an review for A19626

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A19626 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HDAC2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HDAC2. (Distance between topics and target gene indicate popularity.) HDAC2

* Data provided by citexs.com, for reference only.

Publishing research using A19626? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order