Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Glycophorin C (GYPC) Rabbit pAb (A1232)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Glycophorin C (GYPC) Rabbit pAb (A1232)

Western blot analysis of extracts of various cell lines, using Glycophorin C (Glycophorin C (GYPC)) antibody (A1232) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name Glycophorin C (GYPC) Rabbit pAb
Catalog No. A1232
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human Glycophorin C (Glycophorin C (GYPC)) (NP_002092.1).
Sequence MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Gene ID 2995
Swiss prot P04921
Synonyms GE; GPC; GPD; GYPD; CD236; PAS-2; CD236R; PAS-2'; Glycophorin C (GYPC)
Calculated MW 14kDa
Observed MW 34kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, HL-60, Mouse heart
Cellular location Cell membrane, Single-pass type III membrane protein

Research Area

Glycophorin C (GYPC) Rabbit pAb images

ABclonal:Western blot - Glycophorin C (GYPC) Rabbit pAb (A1232)}

Western blot - Glycophorin C (GYPC) Rabbit pAb (A1232)

Western blot analysis of extracts of various cell lines, using Glycophorin C (Glycophorin C (GYPC)) antibody (A1232) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A1232 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GYPC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GYPC. (Distance between topics and target gene indicate popularity.) GYPC

* Data provided by citexs.com, for reference only.

Publishing research using A1232? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order