Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Gli3 Rabbit mAb (A3300)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Gli3 Rabbit mAb (A3300)

Western blot analysis of extracts of HeLa cells, using Gli3 antibody (A3300) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - Gli3 Rabbit mAb (A3300)

Immunofluorescence analysis of C6 cells using Gli3 Rabbit mAb (A3300) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Gli3 Rabbit mAb (A3300)

Immunofluorescence analysis of U-2 OS cells using Gli3 Rabbit mAb (A3300) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Gli3 Rabbit mAb (A3300)

Immunofluorescence analysis of NIH/3T3 cells using Gli3 Rabbit mAb (A3300) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Gli3 Rabbit mAb
Catalog No. A3300
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1941

Background

This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1301-1580 of human Gli3 (P10071).
Sequence PNESAGSMVNGMQNQDPVGQGYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLEGVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIGDMSSLLTSLAEESKFLAVMQ
Gene ID 2737
Swiss prot P10071
Synonyms PHS; ACLS; GCPS; PAPA; PAPB; PAP-A; PAPA1; PPDIV; GLI3FL; GLI3-190; Gli3
Calculated MW 170kDa
Observed MW 190kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouseRat
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa
Cellular location Axoneme, Ciliary base, Ciliary tip, Cilium, Cytoplasm, Cytosol, GLI-SUFU complex, Nuclear speck, Nucleolus, Nucleoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Gli3 Rabbit mAb images

ABclonal:Western blot - Gli3 Rabbit mAb (A3300)}

Western blot - Gli3 Rabbit mAb (A3300)

Western blot analysis of extracts of HeLa cells, using Gli3 antibody (A3300) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - Gli3 Rabbit mAb (A3300)}

Immunofluorescence - Gli3 Rabbit mAb (A3300)

Immunofluorescence analysis of C6 cells using Gli3 Rabbit mAb (A3300) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Gli3 Rabbit mAb (A3300)}

Immunofluorescence - Gli3 Rabbit mAb (A3300)

Immunofluorescence analysis of U-2 OS cells using Gli3 Rabbit mAb (A3300) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Gli3 Rabbit mAb (A3300)}

Immunofluorescence - Gli3 Rabbit mAb (A3300)

Immunofluorescence analysis of NIH/3T3 cells using Gli3 Rabbit mAb (A3300) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A3300 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GLI3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GLI3. (Distance between topics and target gene indicate popularity.) GLI3

* Data provided by citexs.com, for reference only.

Publishing research using A3300? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order