Products > Catalog Antibodies > Polyclonal Antibodies

GPX4 Rabbit pAb (A1933)

Review (1)Publications (4) Datasheet

ABclonal:Western blot - GPX4 Rabbit pAb (A1933)

Western blot analysis of extracts of various cell lines, using GPX4 antibody (A1933) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:10s.

ABclonal:Immunohistochemistry - GPX4 Rabbit pAb (A1933)

Immunohistochemistry of paraffin-embedded rat testis using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens).

ABclonal:Immunohistochemistry - GPX4 Rabbit pAb (A1933)

Immunohistochemistry of paraffin-embedded human appendix using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens).

ABclonal:Immunohistochemistry - GPX4 Rabbit pAb (A1933)

Immunohistochemistry of paraffin-embedded mouse testis using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens).

ABclonal:Immunofluorescence - GPX4 Rabbit pAb (A1933)

Immunofluorescence analysis of C6 cells using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - GPX4 Rabbit pAb (A1933)

Immunofluorescence analysis of L929 cells using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - GPX4 Rabbit pAb (A1933)

Immunoprecipitation analysis of 600ug extracts of Mouse testis cells using 3ug GPX4 antibody (A1933). Western blot was performed from the immunoprecipitate using GPX4 antibody (A1933) at a dilition of 1:1000.

Review
ABclonal: review for GPX4 Rabbit pAb(A1933)

Overview

Product nameGPX4 Rabbit pAb
Catalog No.A1933
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene.
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 30-197 of human GPX4 (NP_002076.2).
SequenceASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Gene ID2879
Swiss protP36969
SynonymsGPX4; GPx-4; GSHPx-4; MCSP; PHGPx; SMDS; snGPx; snPHGPx
Calculated MW19kDa/22kDa
Observed MW22kDa
ReactivityHuman, Mouse, Rat
Tested applicationsWBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP
Recommended dilutionWB 1:500 - 1:2000
IHC 1:50 - 1:200
IF 1:50 - 1:200
IP 1:50 - 1:200
Storage bufferStore at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application keyWestern blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samplesU-87MG, Mouse testis, Mouse kidney, Rat testis
Cellular locationCytoplasm, Mitochondrion
Customer validation

(Mouse liver)

WB(Rattus norvegicus, Homo sapiens)

ABclonal:Western blot - GPX4 Rabbit pAb (A1933) }

Western blot - GPX4 Rabbit pAb (A1933)

Western blot analysis of extracts of various cell lines, using GPX4 antibody (A1933) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:10s.
ABclonal:Immunohistochemistry - GPX4 Rabbit pAb (A1933) }

Immunohistochemistry - GPX4 Rabbit pAb (A1933)

Immunohistochemistry of paraffin-embedded rat testis using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens).
ABclonal:Immunohistochemistry - GPX4 Rabbit pAb (A1933) }

Immunohistochemistry - GPX4 Rabbit pAb (A1933)

Immunohistochemistry of paraffin-embedded human appendix using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens).
ABclonal:Immunohistochemistry - GPX4 Rabbit pAb (A1933) }

Immunohistochemistry - GPX4 Rabbit pAb (A1933)

Immunohistochemistry of paraffin-embedded mouse testis using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens).
ABclonal:Immunofluorescence - GPX4 Rabbit pAb (A1933) }

Immunofluorescence - GPX4 Rabbit pAb (A1933)

Immunofluorescence analysis of C6 cells using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - GPX4 Rabbit pAb (A1933) }

Immunofluorescence - GPX4 Rabbit pAb (A1933)

Immunofluorescence analysis of L929 cells using GPX4 Rabbit pAb (A1933) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - GPX4 Rabbit pAb (A1933) }

Immunoprecipitation - GPX4 Rabbit pAb (A1933)

Immunoprecipitation analysis of 600ug extracts of Mouse testis cells using 3ug GPX4 antibody (A1933). Western blot was performed from the immunoprecipitate using GPX4 antibody (A1933) at a dilition of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.

Submit an review for A1933

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1933 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Publishing research using A1933? Please let us know so that we can cite the reference in this datasheet.

Select size and quantity
5 μL sample size available Add to Cart
Contact us to order