Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GPR142 Rabbit pAb (A16617)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

You may also interested in:

Overview

Product name GPR142 Rabbit pAb
Catalog No. A16617
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

GPR142 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human GPR142 (NP_861455.1).
Sequence MSIMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRIRPSKDSSSFR
Gene ID 350383
Swiss prot Q7Z601
Synonyms PGR2; GPRg1b; GPR142
Calculated MW 51kDa
Observed MW Refer to figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location Cell membrane, Multi-pass membrane protein

Research Area

Inquire About This Product

Submit your question about A16617 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GPR142. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GPR142. (Distance between topics and target gene indicate popularity.) GPR142

* Data provided by citexs.com, for reference only.

Publishing research using A16617? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order