Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GOLPH3 Rabbit pAb (A13121)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GOLPH3 Rabbit pAb (A13121)

Western blot analysis of various lysates using GOLPH3 Rabbit pAb (A13121) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunofluorescence - GOLPH3 Rabbit pAb (A13121)

Immunofluorescence analysis of L929 cells using GOLPH3 Rabbit pAb (A13121) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name GOLPH3 Rabbit pAb
Catalog No. A13121
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-298 of human GOLPH3 (NP_071413.1).
Sequence MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Gene ID 64083
Swiss prot Q9H4A6
Synonyms GOPP1; GPP34; MIDAS; Vps74; GOLPH3
Calculated MW 34kDa
Observed MW 37kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 22Rv1, LO2, HeLa, Mouse testis, Rat lung
Cellular location Cell membrane, Cytoplasmic side, Endosome, Golgi apparatus, Golgi stack membrane, Mitochondrion intermembrane space, Peripheral membrane protein, trans-Golgi network membrane
Customer validation

IHC (Mus musculus)

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

GOLPH3 Rabbit pAb images

ABclonal:Western blot - GOLPH3 Rabbit pAb (A13121)}

Western blot - GOLPH3 Rabbit pAb (A13121)

Western blot analysis of various lysates using GOLPH3 Rabbit pAb (A13121) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
ABclonal:Immunofluorescence - GOLPH3 Rabbit pAb (A13121)}

Immunofluorescence - GOLPH3 Rabbit pAb (A13121)

Immunofluorescence analysis of L929 cells using GOLPH3 Rabbit pAb (A13121) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13121 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GOLPH3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GOLPH3. (Distance between topics and target gene indicate popularity.) GOLPH3

* Data provided by citexs.com, for reference only.

Publishing research using A13121? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order