Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GNG7 Rabbit pAb (A10009)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - GNG7 Rabbit pAb (A10009)

Western blot analysis of extracts of various cell lines, using GNG7 antibody (A10009) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name GNG7 Rabbit pAb
Catalog No. A10009
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway and regulation of adenylate cyclase activity. Predicted to act upstream of or within behavioral fear response; locomotory behavior; and receptor guanylyl cyclase signaling pathway. Located in extracellular exosome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG7 (NP_443079.1).
Sequence MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Gene ID 2788
Swiss prot O60262
Synonyms HG3B; GNG7
Calculated MW 8kDa
Observed MW 12kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse brain, Rat brain
Cellular location Cell membrane, Cytoplasmic side, Lipid-anchor
Customer validation

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GNG7 Rabbit pAb images

ABclonal:Western blot - GNG7 Rabbit pAb (A10009)}

Western blot - GNG7 Rabbit pAb (A10009)

Western blot analysis of extracts of various cell lines, using GNG7 antibody (A10009) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A10009 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GNG7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GNG7. (Distance between topics and target gene indicate popularity.) GNG7

* Data provided by citexs.com, for reference only.

Publishing research using A10009? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order