Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

GLP-1 Rabbit mAb (A4981)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Immunohistochemistry - GLP-1 Rabbit mAb (A4981)

Immunohistochemistry analysis of GLP-1 in paraffin-embedded rat pancreas using GLP-1 Rabbit mAb (A4981) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GLP-1 Rabbit mAb (A4981)

Immunohistochemistry analysis of GLP-1 in paraffin-embedded mouse pancreas using GLP-1 Rabbit mAb (A4981) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - GLP-1 Rabbit mAb (A4981)

Immunofluorescence analysis of rat pancreas using GLP-1 Rabbit mAb (A4981) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - GLP-1 Rabbit mAb (A4981)

Immunofluorescence analysis of mouse pancreas using GLP-1 Rabbit mAb (A4981) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name GLP-1 Rabbit mAb
Catalog No. A4981
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1142

Background

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human GLP-1 (P01275).
Sequence RAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGS
Gene ID 2641
Swiss prot P01275
Synonyms GLP1; GLP2; GRPP; GLP-1
Calculated MW 21kDa
Observed MW

Applications

Reactivity Mouse, Rat
Tested applications Testing results
IHC-P MouseRat
IF/ICC MouseRat
Recommended dilution
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GLP-1 Rabbit mAb images

ABclonal:Immunohistochemistry - GLP-1 Rabbit mAb (A4981)}

Immunohistochemistry - GLP-1 Rabbit mAb (A4981)

Immunohistochemistry analysis of GLP-1 in paraffin-embedded rat pancreas using GLP-1 Rabbit mAb (A4981) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GLP-1 Rabbit mAb (A4981)}

Immunohistochemistry - GLP-1 Rabbit mAb (A4981)

Immunohistochemistry analysis of GLP-1 in paraffin-embedded mouse pancreas using GLP-1 Rabbit mAb (A4981) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - GLP-1 Rabbit mAb (A4981)}

Immunofluorescence - GLP-1 Rabbit mAb (A4981)

Immunofluorescence analysis of rat pancreas using GLP-1 Rabbit mAb (A4981) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - GLP-1 Rabbit mAb (A4981)}

Immunofluorescence - GLP-1 Rabbit mAb (A4981)

Immunofluorescence analysis of mouse pancreas using GLP-1 Rabbit mAb (A4981) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A4981 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GCG. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GCG. (Distance between topics and target gene indicate popularity.) GCG

* Data provided by citexs.com, for reference only.

Publishing research using A4981? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order