Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GATA2 Rabbit pAb (A0677)

Reviews (2) Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GATA2 Rabbit pAb (A0677)

Western blot analysis of HeLa, using GATA2 antibody (A0677) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - GATA2 Rabbit pAb (A0677)

Immunohistochemistry analysis of paraffin-embedded mouse brain using GATA2 antibody (A0677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GATA2 Rabbit pAb (A0677)

Immunohistochemistry analysis of paraffin-embedded rat brain using GATA2 antibody (A0677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Review
ABclonal: review for GATA2 Rabbit pAb(A0677)
Review
ABclonal: review for GATA2 Rabbit pAb(A0677)

You may also interested in:

Overview

Product name GATA2 Rabbit pAb
Catalog No. A0677
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GATA2 (NP_116027.2).
Sequence MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
Gene ID 2624
Swiss prot P23769
Synonyms DCML; IMD21; NFE1B; MONOMAC; GATA2
Calculated MW 51kDa
Observed MW 51kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa
Cellular location Nucleus
Customer validation

WB (SK-N-SHMus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GATA2 Rabbit pAb images

ABclonal:Western blot - GATA2 Rabbit pAb (A0677)}

Western blot - GATA2 Rabbit pAb (A0677)

Western blot analysis of HeLa, using GATA2 antibody (A0677) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - GATA2 Rabbit pAb (A0677)}

Immunohistochemistry - GATA2 Rabbit pAb (A0677)

Immunohistochemistry analysis of paraffin-embedded mouse brain using GATA2 antibody (A0677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GATA2 Rabbit pAb (A0677)}

Immunohistochemistry - GATA2 Rabbit pAb (A0677)

Immunohistochemistry analysis of paraffin-embedded rat brain using GATA2 antibody (A0677) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Submit an review for A0677

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0677 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GATA2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GATA2. (Distance between topics and target gene indicate popularity.) GATA2

* Data provided by citexs.com, for reference only.

Publishing research using A0677? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order