Tested applications:WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human
Product name | GATA1 Rabbit mAb |
---|---|
Catalog No. | A21262 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53588 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GATA1 (NP_002040.1). |
---|---|
Sequence | MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGK |
Gene ID | 2623 |
Swiss prot | P15976 |
Synonyms | GATA1; ERYF1; GATA-1; GF-1; GF1; NF-E1; NFE1; XLANP; XLTDA; XLTT; GATA binding protein 1 |
Calculated MW | 34kDa/35kDa/42kDa |
Observed MW | 47KDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunoprecipitation |
Positive samples | HEL, HeLa(negative) |
Cellular location | Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A21262 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
* For research use only. Not for therapeutic or diagnostic purposes.