Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

GATA1 Rabbit mAb (A21262)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - GATA1 Rabbit mAb (A21262)

Western blot analysis of various lysates, using GATA1 Rabbit mAb (A21262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

You may also interested in:

Overview

Product name GATA1 Rabbit mAb
Catalog No. A21262
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC53588

Background

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GATA1 (NP_002040.1).
Sequence MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGK
Gene ID 2623
Swiss prot P15976
Synonyms GF1; GF-1; NFE1; XLTT; ERYF1; NF-E1; XLANP; XLTDA; GATA-1; HAEADA; GATA1
Calculated MW 43kDa
Observed MW 47kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:000 - 1:5000
  • IP 0.5μg-4μg antibody for 200μg-600μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples HEL
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GATA1 Rabbit mAb images

ABclonal:Western blot - GATA1 Rabbit mAb (A21262)}

Western blot - GATA1 Rabbit mAb (A21262)

Western blot analysis of various lysates, using GATA1 Rabbit mAb (A21262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Inquire About This Product

Submit your question about A21262 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GATA1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GATA1. (Distance between topics and target gene indicate popularity.) GATA1

* Data provided by citexs.com, for reference only.

Publishing research using A21262? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order