Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

GATA1 Rabbit mAb (A21262)

Tested applications:WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human

Western blot analysis of various lysates, using GATA1 antibody (A21262) at 1:1600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	GATA1 Rabbit mAb
Catalog No.	A21262
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53588

Background

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GATA1 (NP_002040.1).
Sequence	MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGK
Gene ID	2623
Swiss prot	P15976
Synonyms	GATA1; ERYF1; GATA-1; GF-1; GF1; NF-E1; NFE1; XLANP; XLTDA; XLTT; GATA binding protein 1
Calculated MW	34kDa/35kDa/42kDa
Observed MW	47KDa

Applications

Reactivity	Human
Tested applications	WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:1000 - 1:1600 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunoprecipitation
Positive samples	HEL, HeLa(negative)
Cellular location	Nucleus