Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GAP43 Rabbit pAb (A6376)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GAP43 Rabbit pAb (A6376)

Western blot analysis of extracts of various cell lines, using GAP43 antibody (A6376) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - GAP43 Rabbit pAb (A6376)

Immunofluorescence analysis of Neuro-2a cells using GAP43 Rabbit pAb (A6376) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - GAP43 Rabbit pAb (A6376)

Immunofluorescence analysis of SH-SY5Y cells using GAP43 Rabbit pAb (A6376) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name GAP43 Rabbit pAb
Catalog No. A6376
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-238 of human GAP43 (NP_002036.1).
Sequence MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Gene ID 2596
Swiss prot P17677
Synonyms B-50; PP46; GAP-43; GAP43
Calculated MW 25kDa
Observed MW 43kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples U-251MG, Neuro-2a, Mouse heart, Rat brain
Cellular location Cell junction, Cell membrane, Cell projection, Cytoplasmic side, Peripheral membrane protein, filopodium membrane, growth cone membrane, synapse
Customer validation

WB (Rattus norvegicus)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GAP43 Rabbit pAb images

ABclonal:Western blot - GAP43 Rabbit pAb (A6376)}

Western blot - GAP43 Rabbit pAb (A6376)

Western blot analysis of extracts of various cell lines, using GAP43 antibody (A6376) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - GAP43 Rabbit pAb (A6376)}

Immunofluorescence - GAP43 Rabbit pAb (A6376)

Immunofluorescence analysis of Neuro-2a cells using GAP43 Rabbit pAb (A6376) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - GAP43 Rabbit pAb (A6376)}

Immunofluorescence - GAP43 Rabbit pAb (A6376)

Immunofluorescence analysis of SH-SY5Y cells using GAP43 Rabbit pAb (A6376) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6376 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GAP43. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GAP43. (Distance between topics and target gene indicate popularity.) GAP43

* Data provided by citexs.com, for reference only.

Publishing research using A6376? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order