Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GABARAP Rabbit pAb (A5616)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GABARAP Rabbit pAb (A5616)

Western blot analysis of extracts of various cell lines, using GABARAP antibody (A5616) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - GABARAP Rabbit pAb (A5616)

Immunohistochemistry analysis of paraffin-embedded rat kidney using GABARAP antibody (A5616) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GABARAP Rabbit pAb (A5616)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using GABARAP antibody (A5616) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - GABARAP Rabbit pAb (A5616)

Immunofluorescence analysis of MCF-7 cells using GABARAP antibody (A5616). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name GABARAP Rabbit pAb
Catalog No. A5616
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAP (NP_009209.1).
Sequence MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Gene ID 11337
Swiss prot O95166
Synonyms MM46; ATG8A; GABARAP-a; GABARAP
Calculated MW 14kDa
Observed MW 16kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SW620, SH-SY5Y, HepG2
Cellular location Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Golgi apparatus membrane, autophagosome, cytoskeleton

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GABARAP Rabbit pAb images

ABclonal:Western blot - GABARAP Rabbit pAb (A5616)}

Western blot - GABARAP Rabbit pAb (A5616)

Western blot analysis of extracts of various cell lines, using GABARAP antibody (A5616) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - GABARAP Rabbit pAb (A5616)}

Immunohistochemistry - GABARAP Rabbit pAb (A5616)

Immunohistochemistry analysis of paraffin-embedded rat kidney using GABARAP antibody (A5616) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GABARAP Rabbit pAb (A5616)}

Immunohistochemistry - GABARAP Rabbit pAb (A5616)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using GABARAP antibody (A5616) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - GABARAP Rabbit pAb (A5616)}

Immunofluorescence - GABARAP Rabbit pAb (A5616)

Immunofluorescence analysis of MCF-7 cells using GABARAP antibody (A5616). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5616 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GABARAP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GABARAP. (Distance between topics and target gene indicate popularity.) GABARAP

* Data provided by citexs.com, for reference only.

Publishing research using A5616? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order