Products > Catalog Antibodies > Monoclonal Antibodies

GABARAP Rabbit mAb (A4335)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using GABARAP Rabbit mAb (A4335) at 1:1000 dilution.293T cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review

Overview

Product name	GABARAP Rabbit mAb
Catalog No.	A4335
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. [provided by RefSeq, Jul 2008]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (O95166).
Sequence	MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
Gene ID	11337
Swiss prot	O95166
Synonyms	ATG8A; GABARAP-a; MM46
Calculated MW	17kDa
Observed MW	16KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting
Positive samples	293T, 293T+Chloroquine, NIH/3T3, NIH/3T3+Chloroquine, C6, C6+Chloroquine
Cellular location	Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Golgi apparatus membrane, autophagosome, cytoskeleton
Customer validation	(PC-3、HL-60、U2-OS、293T)