Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GABARAPL2 Rabbit pAb (A7782)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GABARAPL2 Rabbit pAb (A7782)

Western blot analysis of extracts of mouse brain, using GABARAPL2 antibody (A7782) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - GABARAPL2 Rabbit pAb (A7782)

Immunohistochemistry analysis of paraffin-embedded rat brain using GABARAPL2 antibody (A7782) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GABARAPL2 Rabbit pAb (A7782)

Immunohistochemistry analysis of paraffin-embedded mouse heart using GABARAPL2 antibody (A7782) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name GABARAPL2 Rabbit pAb
Catalog No. A7782
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables ubiquitin protein ligase binding activity. Involved in negative regulation of proteasomal protein catabolic process and protein localization to endoplasmic reticulum. Located in Golgi membrane and autophagosome membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL2 (NP_009216.1).
Sequence MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Gene ID 11345
Swiss prot P60520
Synonyms ATG8; GEF2; ATG8C; GEF-2; GATE16; GATE-16; GABARAPL2
Calculated MW 14kDa
Observed MW 14kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse brain
Cellular location Cytoplasmic vesicle, Golgi apparatus, autophagosome
Customer validation

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GABARAPL2 Rabbit pAb images

ABclonal:Western blot - GABARAPL2 Rabbit pAb (A7782)}

Western blot - GABARAPL2 Rabbit pAb (A7782)

Western blot analysis of extracts of mouse brain, using GABARAPL2 antibody (A7782) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - GABARAPL2 Rabbit pAb (A7782)}

Immunohistochemistry - GABARAPL2 Rabbit pAb (A7782)

Immunohistochemistry analysis of paraffin-embedded rat brain using GABARAPL2 antibody (A7782) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GABARAPL2 Rabbit pAb (A7782)}

Immunohistochemistry - GABARAPL2 Rabbit pAb (A7782)

Immunohistochemistry analysis of paraffin-embedded mouse heart using GABARAPL2 antibody (A7782) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A7782 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GABARAPL2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GABARAPL2. (Distance between topics and target gene indicate popularity.) GABARAPL2

* Data provided by citexs.com, for reference only.

Publishing research using A7782? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order