Western blot analysis of extracts of various cell lines, using GABARAPL1 antibody (A7790) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
| Product name | GABARAPL1 Rabbit pAb |
|---|---|
| Catalog No. | A7790 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL1 (NP_113600.1). |
|---|---|
| Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
| Gene ID | 23710 |
| Swiss prot | Q9H0R8 |
| Synonyms | GABARAPL1; APG8-LIKE; APG8L; ATG8; ATG8B; ATG8L; GEC1 |
| Calculated MW | 14kDa/17kDa |
| Observed MW | 16kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
| Recommended dilution | WB 1:500 - 1:2000 |
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting |
| Positive samples | BT-474, Mouse liver, Mouse kidney, Mouse brain, Rat brain, Rat kidney |
| Cellular location | Cytoplasm, Cytoplasmic vesicle, Cytoplasmic vesicle membrane, Endoplasmic reticulum, Golgi apparatus, Lipid-anchor, autophagosome, cytoskeleton |
* For research use only. Not for therapeutic or diagnostic purposes.
Submit your question about A7790 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
