| Product name | GABARAPL1 Rabbit pAb |
|---|---|
| Catalog No. | A7790 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL1 (NP_113600.1). |
|---|---|
| Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
| Gene ID | 23710 |
| Swiss prot | Q9H0R8 |
| Synonyms | GABARAPL1; APG8-LIKE; APG8L; ATG8; ATG8B; ATG8L; GEC1 |
| Calculated MW | 14kDa/17kDa |
| Observed MW | 16kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
| Recommended dilution | WB 1:500 - 1:2000 |
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting |
| Positive samples | BT-474, Mouse liver, Mouse kidney, Mouse brain, Rat brain, Rat kidney |
| Cellular location | Cytoplasm, Cytoplasmic vesicle, Cytoplasmic vesicle membrane, Endoplasmic reticulum, Golgi apparatus, Lipid-anchor, autophagosome, cytoskeleton |
Submit your question about A7790 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
