Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

G3BP1 Rabbit mAb (A3968)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - G3BP1 Rabbit mAb (A3968)

Western blot analysis of various lysates using G3BP1 Rabbit mAb (A3968) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - G3BP1 Rabbit mAb (A3968)

Confocal imaging of HeLa cells using G3BP1 Rabbit mAb (A3968, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - G3BP1 Rabbit mAb (A3968)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg G3BP1 Rabbit mAb (A3968). Western blot was performed from the immunoprecipitate using G3BP1 Rabbit mAb (A3968) at a dilution of 1:1000.

You may also interested in:

Overview

Product name G3BP1 Rabbit mAb
Catalog No. A3968
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0875

Background

This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human G3BP1 (Q13283).
Sequence EVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGM
Gene ID 10146
Swiss prot Q13283
Synonyms G3BP; HDH-VIII; G3BP1
Calculated MW 52kDa
Observed MW 68kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouse
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, 293T, PC-3, Mouse testis, Rat testis
Cellular location Cell membrane, Cytoplasm, Cytoplasmic granule, Nucleus, cytosol
Customer validation

WB (Homo sapiens, Chlorocebus aethiops)

IF (Homo sapiens, Chlorocebus aethiops)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

G3BP1 Rabbit mAb images

ABclonal:Western blot - G3BP1 Rabbit mAb (A3968)}

Western blot - G3BP1 Rabbit mAb (A3968)

Western blot analysis of various lysates using G3BP1 Rabbit mAb (A3968) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - G3BP1 Rabbit mAb (A3968)}

Immunofluorescence - G3BP1 Rabbit mAb (A3968)

Confocal imaging of HeLa cells using G3BP1 Rabbit mAb (A3968, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
ABclonal:Immunoprecipitation - G3BP1 Rabbit mAb (A3968)}

Immunoprecipitation - G3BP1 Rabbit mAb (A3968)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg G3BP1 Rabbit mAb (A3968). Western blot was performed from the immunoprecipitate using G3BP1 Rabbit mAb (A3968) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A3968 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on G3BP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to G3BP1. (Distance between topics and target gene indicate popularity.) G3BP1

* Data provided by citexs.com, for reference only.

Publishing research using A3968? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order