Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FasLG Rabbit pAb (A0234)

Review (1) Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - FasLG Rabbit pAb (A0234)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with FasLG using FasLG Rabbit pAb(A0234) at 1:600 dilution. 
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human esophageal cancer using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human tonsil using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human colon using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human placenta using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human lung cancer using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for FasLG Rabbit pAb(A0234)

You may also interested in:

Overview

Product name FasLG Rabbit pAb
Catalog No. A0234
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 101-200 of human FasLG (NP_000630.1).
Sequence MFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQ
Gene ID 356
Swiss prot P48023
Synonyms APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; TNLG1A; APT1LG1; FasLG
Calculated MW 31kDa
Observed MW 41kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293T transfected with FasLG
Cellular location Cell membrane, Cytoplasmic vesicle lumen, Lysosome lumen, Nucleus, Secreted, Single-pass type II membrane protein
Customer validation

WB (Jurkat cellsHomo sapiens, Homo sapiens, Anatinae, Mus musculus, Rattus norvegicus)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FasLG Rabbit pAb images

ABclonal:Western blot - FasLG Rabbit pAb (A0234)}

Western blot - FasLG Rabbit pAb (A0234)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with FasLG using FasLG Rabbit pAb(A0234) at 1:600 dilution. 
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)}

Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human esophageal cancer using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)}

Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human tonsil using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)}

Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human colon using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)}

Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human placenta using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - FasLG Rabbit pAb (A0234)}

Immunohistochemistry - FasLG Rabbit pAb (A0234)

Immunohistochemistry analysis of FasLG in paraffin-embedded Human lung cancer using FasLG Rabbit pAb (A0234) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A0234

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0234 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FASLG. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FASLG. (Distance between topics and target gene indicate popularity.) FASLG

* Data provided by citexs.com, for reference only.

Publishing research using A0234? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order