Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FXR2 Rabbit pAb (A4313)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - FXR2 Rabbit pAb (A4313)

Western blot analysis of extracts of various cell lines, using FXR2 antibody (A4313) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - FXR2 Rabbit pAb (A4313)

Immunofluorescence analysis of U2OS cells using FXR2 antibody (A4313) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name FXR2 Rabbit pAb
Catalog No. A4313
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a RNA binding protein containing two KH domains and one RCG box, which is similar to FMRP and FXR1. It associates with polyribosomes, predominantly with 60S large ribosomal subunits. This encoded protein may self-associate or interact with FMRP and FXR1. It may have a role in the development of fragile X cognitive disability syndrome.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human FXR2 (NP_004851.2).
Sequence RRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLP
Gene ID 9513
Swiss prot P51116
Synonyms FXR2P; FMR1L2; FXR2
Calculated MW 74kDa
Observed MW 104kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, MCF7, U-251MG, Mouse liver, Mouse heart
Cellular location Cytoplasm
Customer validation

WB (Mus musculus )

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FXR2 Rabbit pAb images

ABclonal:Western blot - FXR2 Rabbit pAb (A4313)}

Western blot - FXR2 Rabbit pAb (A4313)

Western blot analysis of extracts of various cell lines, using FXR2 antibody (A4313) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - FXR2 Rabbit pAb (A4313)}

Immunofluorescence - FXR2 Rabbit pAb (A4313)

Immunofluorescence analysis of U2OS cells using FXR2 antibody (A4313) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A4313 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FXR2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FXR2. (Distance between topics and target gene indicate popularity.) FXR2

* Data provided by citexs.com, for reference only.

Publishing research using A4313? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order