Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FXR2 Rabbit pAb (A4313)

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - FXR2 Rabbit pAb (A4313)

Western blot analysis of extracts of various cell lines, using FXR2 antibody (A4313) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - FXR2 Rabbit pAb (A4313)

Immunofluorescence analysis of U2OS cells using FXR2 antibody (A4313) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name	FXR2 Rabbit pAb
Catalog No.	A4313
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a RNA binding protein containing two KH domains and one RCG box, which is similar to FMRP and FXR1. It associates with polyribosomes, predominantly with 60S large ribosomal subunits. This encoded protein may self-associate or interact with FMRP and FXR1. It may have a role in the development of fragile X cognitive disability syndrome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 550-650 of human FXR2 (NP_004851.2).
Sequence	RRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLP
Gene ID	9513
Swiss prot	P51116
Synonyms	FXR2P; FMR1L2; FXR2
Calculated MW	74kDa
Observed MW	104kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key	Western blotting Immunofluorescence
Positive samples	HeLa, MCF7, U-251MG, Mouse liver, Mouse heart
Cellular location	Cytoplasm
Customer validation	WB (Mus musculus )

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FXR2 Rabbit pAb images

Western blot - FXR2 Rabbit pAb (A4313)

Immunofluorescence - FXR2 Rabbit pAb (A4313)

Immunofluorescence analysis of U2OS cells using FXR2 antibody (A4313) at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Protocols

Inquire About This Product

Submit your question about A4313 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

*Your Question

*First Name

*Last Name

*Work Email

*Phone

*Institution

Related Targets

Based on existing publications, the following genes are closely related to research on FXR2. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to FXR2. (Distance between topics and target gene indicate popularity.) FXR2

* Data provided by citexs.com, for reference only.