Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FTO Rabbit pAb (A1438)

Publications (16) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - FTO Rabbit pAb (A1438)

Western blot analysis of various lysates using FTO Rabbit pAb (A1438) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - FTO Rabbit pAb (A1438)

Immunoprecipitation analysis of 300 μg extracts of SH-SY5Y cells using 3 μg FTO antibody (A1438). Western blot was performed from the immunoprecipitate using FTO antibody (A1438) at a dilution of 1:1000.

You may also interested in:

Overview

Product name FTO Rabbit pAb
Catalog No. A1438
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 327-504 of human FTO (NP_001073901.1).
Sequence STGTLDYILQRCQLALQNVCDDVDNDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAK
Gene ID 79068
Swiss prot Q9C0B1
Synonyms GDFD; ALKBH9; BMIQ14; FTO
Calculated MW 58kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples HeLa, 293T, SH-SY5Y
Cellular location Nucleus, Nucleus speckle
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus, Mus musculu)

IHC (Mus musculus)

Co-IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FTO Rabbit pAb images

ABclonal:Western blot - FTO Rabbit pAb (A1438)}

Western blot - FTO Rabbit pAb (A1438)

Western blot analysis of various lysates using FTO Rabbit pAb (A1438) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunoprecipitation - FTO Rabbit pAb (A1438)}

Immunoprecipitation - FTO Rabbit pAb (A1438)

Immunoprecipitation analysis of 300 μg extracts of SH-SY5Y cells using 3 μg FTO antibody (A1438). Western blot was performed from the immunoprecipitate using FTO antibody (A1438) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A1438 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FTO. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FTO. (Distance between topics and target gene indicate popularity.) FTO

* Data provided by citexs.com, for reference only.

Publishing research using A1438? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order