Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

FOXP3 Rabbit mAb (A4953)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - FOXP3 Rabbit mAb (A4953)

Western blot analysis of lysates from Jurkat cells, using FOXP3 Rabbit mAb (A4953) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - FOXP3 Rabbit mAb (A4953)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg FOXP3 antibody (A4953). Western blot was performed from the immunoprecipitate using FOXP3 antibody (A4953) at a dilution of 1:1000.

You may also interested in:

Overview

Product name FOXP3 Rabbit mAb
Catalog No. A4953
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1159

Background

The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 286-431 of human FOXP3 (Q9BZS1).
Sequence GSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP
Gene ID 50943
Swiss prot Q9BZS1
Synonyms JM2; AIID; IPEX; PIDX; XPID; DIETER; FOXP3
Calculated MW 47kDa
Observed MW 45kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples Jurkat
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus)

IF (Homo sapiens, Rattus norvegicus)

IHC (Rattus norvegicus)

FC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FOXP3 Rabbit mAb images

ABclonal:Western blot - FOXP3 Rabbit mAb (A4953)}

Western blot - FOXP3 Rabbit mAb (A4953)

Western blot analysis of lysates from Jurkat cells, using FOXP3 Rabbit mAb (A4953) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunoprecipitation - FOXP3 Rabbit mAb (A4953)}

Immunoprecipitation - FOXP3 Rabbit mAb (A4953)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg FOXP3 antibody (A4953). Western blot was performed from the immunoprecipitate using FOXP3 antibody (A4953) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A4953 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FOXP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FOXP3. (Distance between topics and target gene indicate popularity.) FOXP3

* Data provided by citexs.com, for reference only.

Publishing research using A4953? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order