Reviews (3) Publications (24) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat, Monkey
Product name | FOXO1 Rabbit pAb |
---|---|
Catalog No. | A2934 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 340-580 of human FOXO1 (NP_002006.2). |
---|---|
Sequence | EGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSS |
Gene ID | 2308 |
Swiss prot | Q12778 |
Synonyms | FKH1; FKHR; FOXO1A; FOXO1 |
Calculated MW | 70kDa |
Observed MW | 74kDa |
Reactivity | Human, Mouse, Rat, Monkey |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | Mouse liver, Mouse brain, Rat kidney |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB (293T, HEK293T,DLD-1Homo sapiens, Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus, Gallus gallus, Bos taurus) IF (SW480Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A2934 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on FOXO1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to FOXO1. (Distance between topics and target gene indicate popularity.) FOXO1
* Data provided by citexs.com, for reference only.
Publishing research using A2934? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
!OUT OF STOCK
See Below for Alternatives