Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FOXO1 Rabbit pAb (A2934)

Reviews (3) Publications (24) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Monkey

ABclonal:Western blot - FOXO1 Rabbit pAb (A2934)

Western blot analysis of various lysates using FOXO1 Rabbit pAb (A2934) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - FOXO1 Rabbit pAb (A2934)

Immunofluorescence analysis of HeLa cells using FOXO1 Rabbit pAb (A2934) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - FOXO1 Rabbit pAb (A2934)

Immunofluorescence analysis of NIH/3T3 cells using FOXO1 Rabbit pAb (A2934) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for FOXO1 Rabbit pAb(A2934)
Review
ABclonal: review for FOXO1 Rabbit pAb(A2934)
Review
ABclonal: review for FOXO1 Rabbit pAb(A2934)

You may also interested in:

Overview

Product name FOXO1 Rabbit pAb
Catalog No. A2934
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 340-580 of human FOXO1 (NP_002006.2).
Sequence EGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSS
Gene ID 2308
Swiss prot Q12778
Synonyms FKH1; FKHR; FOXO1A; FOXO1
Calculated MW 70kDa
Observed MW 74kDa

Applications

Reactivity Human, Mouse, Rat, Monkey
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse liver, Mouse brain, Rat kidney
Cellular location Cytoplasm, Nucleus
Customer validation

WB (293T, HEK293T,DLD-1Homo sapiens, Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus, Gallus gallus, Bos taurus)

IF (SW480Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FOXO1 Rabbit pAb images

ABclonal:Western blot - FOXO1 Rabbit pAb (A2934)}

Western blot - FOXO1 Rabbit pAb (A2934)

Western blot analysis of various lysates using FOXO1 Rabbit pAb (A2934) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - FOXO1 Rabbit pAb (A2934)}

Immunofluorescence - FOXO1 Rabbit pAb (A2934)

Immunofluorescence analysis of HeLa cells using FOXO1 Rabbit pAb (A2934) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - FOXO1 Rabbit pAb (A2934)}

Immunofluorescence - FOXO1 Rabbit pAb (A2934)

Immunofluorescence analysis of NIH/3T3 cells using FOXO1 Rabbit pAb (A2934) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A2934

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2934 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FOXO1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FOXO1. (Distance between topics and target gene indicate popularity.) FOXO1

* Data provided by citexs.com, for reference only.

Publishing research using A2934? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order