Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FAM234A Rabbit pAb (A16580)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - FAM234A Rabbit pAb (A16580)

Western blot analysis of various lysates using FAM234A Rabbit pAb (A16580) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

You may also interested in:

Overview

Product name FAM234A Rabbit pAb
Catalog No. A16580
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Located in cell surface.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 70-400 of human FAM234A (NP_114428.1).
Sequence IPCPDRPASQRMWRIDYSAAVIYDFLAVDDINGDRIQDVLFLYKNTNSSNNFSRSCVDEGFSSPCTFAAAVSGANGSTLWERPVAQDVALVECAVPQPRGSEAPSACILVGRPSSFIAVNLFTGETLWNHSSSFSGNASILSPLLQVPDVDGDGAPDLLVLTQEREEVSGHLYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSGGPFKSDPHWESMLNATTRRMLSHSSGAVRYLMHVPGNAGADVLLVGSEAFVLLDGQELTPRWTPKAAHVLRKPIFGRYKPDTLAVAVENGTGTDRQILFL
Gene ID 83986
Swiss prot Q9H0X4
Synonyms gs19; ITFG3; C16orf9; FAM234A
Calculated MW 60kDa
Observed MW 67kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SGC-7901, HepG2, OVCAR3
Cellular location Membrane, Single-pass type II membrane protein

FAM234A Rabbit pAb images

ABclonal:Western blot - FAM234A Rabbit pAb (A16580)}

Western blot - FAM234A Rabbit pAb (A16580)

Western blot analysis of various lysates using FAM234A Rabbit pAb (A16580) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Inquire About This Product

Submit your question about A16580 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FAM234A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FAM234A. (Distance between topics and target gene indicate popularity.) FAM234A

* Data provided by citexs.com, for reference only.

Publishing research using A16580? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order