Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FAM107A Rabbit pAb (A16493)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - FAM107A Rabbit pAb (A16493)

Western blot analysis of various lysates using FAM107A Rabbit pAb (A16493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name FAM107A Rabbit pAb
Catalog No. A16493
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable actin binding activity. Involved in several processes, including negative regulation of G1/S transition of mitotic cell cycle; negative regulation of focal adhesion assembly; and regulation of cytoskeleton organization. Located in several cellular components, including focal adhesion; ruffle membrane; and stress fiber.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human FAM107A (NP_009108.1).
Sequence MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
Gene ID 11170
Swiss prot O95990
Synonyms DRR1; TU3A; FAM107A
Calculated MW 17kDa
Observed MW 18kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse brain, Rat brain
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FAM107A Rabbit pAb images

ABclonal:Western blot - FAM107A Rabbit pAb (A16493)}

Western blot - FAM107A Rabbit pAb (A16493)

Western blot analysis of various lysates using FAM107A Rabbit pAb (A16493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A16493 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FAM107A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FAM107A. (Distance between topics and target gene indicate popularity.) FAM107A

* Data provided by citexs.com, for reference only.

Publishing research using A16493? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order