Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

FAK Rabbit mAb (A11131)

Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - FAK Rabbit mAb (A11131)

Western blot analysis of extracts of various cell lines, using FAK pAb (A11131) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - FAK Rabbit mAb (A11131)

Western blot analysis of extracts of MCF7 cells, using FAK pAb (A11131) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - FAK Rabbit mAb (A11131)

Confocal imaging of HeLa cells using FAK Rabbit mAb (A11131, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

You may also interested in:

Overview

Product name FAK Rabbit mAb
Catalog No. A11131
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0171

Background

This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FAK (Q05397).
Sequence TVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIG
Gene ID 5747
Swiss prot Q05397
Synonyms FAK; FADK; FAK1; FRNK; FADK 1; PPP1R71; p125FAK; pp125FAK
Calculated MW 119kDa
Observed MW 125kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouse
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples MCF7, Mouse brain, Rat brain
Cellular location Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Nucleus, Peripheral membrane protein, cell cortex, centrosome, cytoskeleton, focal adhesion, microtubule organizing center
Customer validation

WB (Homo sapiens, Rattus norvegicus, mus musculus)

IF (Homo sapiens, Rattus norvegicus)

IHC (Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FAK Rabbit mAb images

ABclonal:Western blot - FAK Rabbit mAb (A11131)}

Western blot - FAK Rabbit mAb (A11131)

Western blot analysis of extracts of various cell lines, using FAK pAb (A11131) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - FAK Rabbit mAb (A11131)}

Western blot - FAK Rabbit mAb (A11131)

Western blot analysis of extracts of MCF7 cells, using FAK pAb (A11131) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - FAK Rabbit mAb (A11131)}

Immunofluorescence - FAK Rabbit mAb (A11131)

Confocal imaging of HeLa cells using FAK Rabbit mAb (A11131, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Inquire About This Product

Submit your question about A11131 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PTK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PTK2. (Distance between topics and target gene indicate popularity.) PTK2

* Data provided by citexs.com, for reference only.

Publishing research using A11131? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order