Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human
Product name | FADD Rabbit mAb |
---|---|
Catalog No. | A19049 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human FADD (Q13158). |
---|---|
Sequence | LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN |
Gene ID | 8772 |
Swiss prot | Q13158 |
Synonyms | GIG3; MORT1; FADD; FADD |
Calculated MW | 28kDa |
Observed MW | 28kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HeLa, A-431, U-251MG |
Cellular location |
Submit your question about A19049 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
* For research use only. Not for therapeutic or diagnostic purposes.