Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EZH2/KMT6 Rabbit pAb (A11085)

Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - EZH2/KMT6 Rabbit pAb (A11085)

Western blot analysis of various lysates using EZH2/KMT6 Rabbit pAb (A11085) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - EZH2/KMT6 Rabbit pAb (A11085)

Immunofluorescence analysis of U2OS cells using EZH2/KMT6 Rabbit pAb (A11085).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

You may also interested in:

Overview

Product name EZH2/KMT6 Rabbit pAb
Catalog No. A11085
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EZH2/KMT6 (NP_001190176.1).
Sequence MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQ
Gene ID 2146
Swiss prot Q15910
Synonyms WVS; ENX1; KMT6; WVS2; ENX-1; EZH2b; KMT6A; EZH2/KMT6
Calculated MW 85kDa
Observed MW 78-110kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples MCF7, 293T, HepG2, HeLa, SW620, Raji, Mouse testis
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

EZH2/KMT6 Rabbit pAb images

ABclonal:Western blot - EZH2/KMT6 Rabbit pAb (A11085)}

Western blot - EZH2/KMT6 Rabbit pAb (A11085)

Western blot analysis of various lysates using EZH2/KMT6 Rabbit pAb (A11085) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - EZH2/KMT6 Rabbit pAb (A11085)}

Immunofluorescence - EZH2/KMT6 Rabbit pAb (A11085)

Immunofluorescence analysis of U2OS cells using EZH2/KMT6 Rabbit pAb (A11085).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Inquire About This Product

Submit your question about A11085 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EZH2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EZH2. (Distance between topics and target gene indicate popularity.) EZH2

* Data provided by citexs.com, for reference only.

Publishing research using A11085? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order