Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ESRRA Rabbit mAb (A4176)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ESRRA Rabbit mAb (A4176)

Western blot analysis of extracts of various cell lines, using ESRRA Rabbit mAb (A4176) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

You may also interested in:

Overview

Product name ESRRA Rabbit mAb
Catalog No. A4176
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0919

Background

The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ESRRA (P11474).
Sequence MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACK
Gene ID 2101
Swiss prot P11474
Synonyms ERR1; ERRa; ESRL1; NR3B1; ERRalpha; ESRRA
Calculated MW 46kDa
Observed MW 48-50kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, 293T, Mouse brain
Cellular location Nucleus, Cytoplasm
Customer validation

ChIP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ESRRA Rabbit mAb images

ABclonal:Western blot - ESRRA Rabbit mAb (A4176)}

Western blot - ESRRA Rabbit mAb (A4176)

Western blot analysis of extracts of various cell lines, using ESRRA Rabbit mAb (A4176) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Inquire About This Product

Submit your question about A4176 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ESRRA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ESRRA. (Distance between topics and target gene indicate popularity.) ESRRA

* Data provided by citexs.com, for reference only.

Publishing research using A4176? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order