Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ERK1/2 Rabbit mAb (A4782)

Publications (52) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ERK1/2 Rabbit mAb (A4782)

Western blot analysis of various lysates, using ERK1/2 antibody (A4782) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)

Immunohistochemistry analysis of paraffin-embedded human kidney using ERK1/2 Rabbit mAb (A4782) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)

Immunohistochemistry analysis of paraffin-embedded human testis using ERK1/2 Rabbit mAb (A4782) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using ERK1/2 Rabbit mAb (A4782) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ERK1/2 Rabbit mAb (A4782)

Confocal imaging of HeLa cells using ERK1/2 Rabbit mAb (A4782, dilution 1:50)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

You may also interested in:

Overview

Product name ERK1/2 Rabbit mAb
Catalog No. A4782
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0212

Background

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014]

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK2 (P28482).
Sequence HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Gene ID 55945595
Swiss prot P28482P27361
Synonyms ERK; ERK-2; ERK2; ERT1; MAPK2; P42MAPK; PRKM1; PRKM2; p38; p40; p41; p41mapk; p42-MAPK; 5594/5595; ERK1/2
Calculated MW 42, 44kDa
Observed MW 42kDa/44kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanMouseRat
WB HumanMouseRat
IF/ICC MouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, 293T, A-431, NIH/3T3, PC-12, C6, Mouse brain, Rat brain
Cellular location caveola, cytoplasm, cytoskeleton, cytosol, early endosome, endoplasmic reticulum lumen, extracellular region, focal adhesion, Golgi apparatus, late endosome, microtubule organizing center, mitochondrion, mitotic spindle, nucleoplasm, nucleus, plasma membrane
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus, floral, Sus scrofa)

IHC (Mus musculus)

ELISA (Rattus norvegicus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ERK1/2 Rabbit mAb images

ABclonal:Western blot - ERK1/2 Rabbit mAb (A4782)}

Western blot - ERK1/2 Rabbit mAb (A4782)

Western blot analysis of various lysates, using ERK1/2 antibody (A4782) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)}

Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)

Immunohistochemistry analysis of paraffin-embedded human kidney using ERK1/2 Rabbit mAb (A4782) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)}

Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)

Immunohistochemistry analysis of paraffin-embedded human testis using ERK1/2 Rabbit mAb (A4782) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)}

Immunohistochemistry - ERK1/2 Rabbit mAb (A4782)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using ERK1/2 Rabbit mAb (A4782) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ERK1/2 Rabbit mAb (A4782)}

Immunofluorescence - ERK1/2 Rabbit mAb (A4782)

Confocal imaging of HeLa cells using ERK1/2 Rabbit mAb (A4782, dilution 1:50)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Inquire About This Product

Submit your question about A4782 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAPK1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAPK1. (Distance between topics and target gene indicate popularity.) MAPK1

* Data provided by citexs.com, for reference only.

Publishing research using A4782? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order